Contact Us
Click here to leave a message
Sign In
Close

Peptide YY (PYY), human

PURITY:≥98%

CAT.NO:ONP10755

CAS.NO:118997-30-1

Pack Size Availability Price/USD Quantity
0.5mg Check Stock 200
Bulk Size Get quote
BIOLOGICAL INFORMATION
Description Peptide YY (PYY) is mainly found in gastrointestinal tract. It is believed to involve feeding behavior. It is a gut hormone that inhibits both secretin- and cholecystokinin-stimulated pancreatic secretion. This peptide is an endogenous nonselective agonist at NPY receptors.
Application Melanocortin
Note For research only, not for human use!
CHEMICAL INFORMATION
CAT No. ONP10755
CAS No. 118997-30-1
Name Peptide YY (PYY), human
Chemical Name Peptide-YY-(PYY),-human
Purity ≥98%
Synonyms PYY
Formula C194H295N55O57
Molecular Weight 4309.75
One Letter Code YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Three Letter Code TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
SMILES CCC(C)C(C(=O)NC(CCCCN)C(=O)N1CCCC1C(=O)NC(CCC(=O)O)C(=O)NC(C)C(=O)N2CCCC2C(=O)NCC(=O)NC(CCC(=O)O)C(=O)NC(CC(=O)O)C(=O)NC(C)C(=O)NC(CO)C(=O)N3CCCC3C(=O)NC(CCC(=O)O)C(=O)NC(CCC(=O)O)C(=O)NC(CC(C)C)C(=O)NC(CC(=O)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC4=CC=C(C=C4)O)C(=O)NC(CC5=CC=C(C=C5)O)C(=O)NC(C)C(=O)NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC6=CNC=N6)C(=O)NC(CC7=CC=C(C=C7)O)C(=O)NC(CC(C)C)C(=O)NC(CC(=O)N)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(C(C)O)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCC(=O)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC8=CC=C(C=C8)O)C(=O)N)NC(=O)C9CCCN9C(=O)C(CC1=CC=C(C=C1)O)N
InChI Key YNXLOPYTAAFMTN-SBUIBGKBSA-N
Source Synthetic
Form Dry Powder
Color White
Solubility N/A
SHIPPING & STORAGE
Storage 4 degree ℃ for short term (weeks) and -20 degree ℃ for long term.
Stability ≥ 2 years
PROMOTIONS & EVENTS
Connect with GM:NEWSLETTER